DPCstruct | MC14877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9QTB2 | 67-194 | VALARPVPRTAERRAARFGLLDQAPVVVTEGAHLPQVGLLLALPGLEATGLLRVAEQVYGPMRHGFYGLRVTLLMGVFMALLREPRA… |
| A0A2W0AT34 | 1-119 | MGYATTRTLERVAAAIGVLESAPIEFESTRDVAAGGVLLAVPALLAQGLLRHRPQSYQLPKGFYGIDSIFLLLALMALTCIGSVEQL… |
| A0A848A890 | 219-336 | None |
| A0A2S4A0U5 | 71-193 | None |
| A0A1E3X5R9 | 7-133 | None |
| A0A7X5U5H6 | 190-309 | None |
| A0A3C1FUF1 | 1-104 | None |
| A0A7C7Z5K4 | 149-290 | None |
| A0A7Z8R2Y7 | 1-126 | None |
| A0A0D8HH36 | 248-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.