DPCstruct | MC14875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 18.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.07 |
| Pfam Score | 57.14 |
| Assigned Pfam label(s) | PF05772- PF07105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2BH87 | 2-88 | FHALCGDVSKQMTLNNEPLKLWQWKNVFVSGHWMVTTGAKESPLIRGIEGELLNIRESTSQMGKKRMSSLIEYSTAWAVQSGVKLRT |
| A0A2D7VZJ8 | 8-120 | TSFDFKAKAIDAIRTASEGQVVTIQPRNRTTEQNSLYWALLQNLSEQYVNEDNRTFSADTWHEYFKQQYLPKDYVELPDGNVKEKER… |
| A0A1B9N5R5 | 1-149 | None |
| A0A4Z0DJP1 | 84-221 | None |
| A0A3D4XPW5 | 1-131 | None |
| A0A7T2GKJ0 | 17-140 | None |
| A0A316RAY2 | 4-118 | None |
| A0A2V3Q3F9 | 1-103 | None |
| A0A2G2PJ97 | 12-162 | None |
| A0A0J6SGC8 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.