DPCstruct | MC14873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D7VQJ8 | 1-141 | MATPFLFYLYKFAPSDSKIWETPFGTIESGEFKSAQIYLHALVTKLTFIILTATWFLTSRNWWKYAILVPLTMFLFQLSGVINYKIS… |
| A0A1V6LQX6 | 138-282 | LLLLAQPFLNLSTIFVPENLIQLDLLILIIPNFGYADVGIFLNTIVFKSNLFIIYSIWFLTEKRWWRYAILSPILLLGNQVYNILFT… |
| A0A4U1M8I3 | 15-179 | None |
| A0A559RLY4 | 24-158 | None |
| A0A098LUS2 | 2-155 | None |
| A0A239A4Q8 | 14-141 | None |
| A0A4U1LTW1 | 2-155 | None |
| A0A7W2S2E4 | 64-214 | None |
| A8UPB2 | 15-162 | None |
| I3C9D7 | 2-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.