DPCstruct | MC14872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 10 aa |
| Standard deviation of domain lengths | 10.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9I415 | 3-143 | LNSIYSNIQPKVANNVMKAAKFYLVADKRRTGREDCGYATGRQWMALEMPNRVGDWAEVLGEVYDKMASYGLGNREVYYRAILDFAL… |
| A0A135SG79 | 203-352 | VDTISDNLKMKVATKAMKASKLHLVADRHKDAATREGCGTDIGRQWMELRSGEEYCFYLMRESADTFWYEAEPRIYVAMEDHGIGNR… |
| X0JJ56 | 503-657 | None |
| A0A0G4MCE6 | 808-951 | None |
| A0A2H3U4W5 | 40-159 | None |
| N4UR33 | 109-263 | None |
| A0A2V1DLI2 | 641-783 | None |
| A0A559KYL5 | 66-218 | None |
| A0A0N0V5F3 | 1-139 | None |
| A0A366PHW1 | 86-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.