DPCstruct | MC14870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 240 ± 37 aa |
| Standard deviation of domain lengths | 37.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4C446 | 191-445 | MDAKESWKKSIFKSVYFPIADAFVSHIGGMYMAICTPANPDEEFVLADNCYNVTEGPTTSYYDETSGRYMTRSPRFHMFAPISPRLM… |
| W9HG98 | 1-267 | MEKRGIQHPIDVWLQGLSAIIDVDMSVSANWRETLQATVYYALFVHFEEHIREFWMSFCTPSSEYEEFILPDTASTIYEGPTVDFQD… |
| A0A2A9NDB0 | 267-512 | None |
| A0A4Q2DGC0 | 234-510 | None |
| A0A165TDE4 | 2-269 | None |
| A0A3N4IKD5 | 170-399 | None |
| A0A3N4K9E0 | 2-188 | None |
| A0A2T6ZX11 | 479-733 | None |
| A0A2A9NLR0 | 227-423 | None |
| A0A1Y2GD92 | 166-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.