DPCstruct | MC1487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 19.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835G536 | 65-189 | TRYTLYILDELLAYIQNKISIADEASLVQICASTFTSEQIQNSKSLLIESLSSEVRSTVRKGKGKDNRVLYDIIAIFKTTEPDVLPV… |
| A0A5E4QRZ4 | 1-137 | MTGQLIIINEFLTFVQNKLDILDEQSITQICATNFTDTEIEDGKGILYKSCGDKVRHVQRKGDDKKKRNIKDVIRLLKEVDPDAQPN… |
| R7VE86 | 1-165 | None |
| R7VJ18 | 1-137 | None |
| R7TFL8 | 1-181 | None |
| R7TRU6 | 2-146 | None |
| A0A5E4Q2X3 | 1-122 | None |
| A0A5E4Q3M8 | 1-128 | None |
| T1F063 | 1-182 | None |
| T1F3P7 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.