DPCstruct | MC14869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 286 ± 41 aa |
| Standard deviation of domain lengths | 40.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496V5P6 | 173-439 | AIDMSTDIVTNDNAPSLLSQVNEIAILNDNDWQLTQNDNGQLQLTITDINYDINYALTPERVKQAKANQAKLTLNRDGSATFVTKPG… |
| A0A0S2KEG2 | 999-1237 | SEIVVDAETGAVTIILPGETYAGAIVAVRSVPAVVPNGIRIRRDGRGIIVTDGIAVELAPVALNLGGFTTAVEDAGFGFTLRNNATI… |
| A0A7C2AF35 | 543-825 | None |
| A0A0Q8TDD3 | 38-293 | None |
| A0A1F4CX03 | 160-403 | None |
| A0A1W9X1Q1 | 471-747 | None |
| A0A3C0P7U4 | 363-661 | None |
| A7BST5 | 45-346 | None |
| A7BVI4 | 88-401 | None |
| A7BWA3 | 566-993 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.