DPCstruct | MC14867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1T582 | 18-124 | WINLQYYASTVAPHFYGSGNKATQTVTSGVGVMQGNASDLMYGLSWQSVMAADRTMYHSPIRLLVVIQAPDYVVARLLANNEHFARK… |
| A0A0S2K9U3 | 10-128 | WINLQYYASTVDNRIYGSGNKLLHNVVGENEGVFEGNGGDLRIGLAMQLHDGGHWRHQPLRLSVFIAAPRDAILTIVRKHAAVAELI… |
| A0A7U1E947 | 51-177 | None |
| A0A519UGZ0 | 559-669 | None |
| M1GPB4 | 62-177 | None |
| A0A1F3W8L4 | 5-112 | None |
| A0A2T2UVI7 | 152-243 | None |
| A0A2D6PM46 | 4-105 | None |
| U1Q6R9 | 113-229 | None |
| A0A7V5MHM7 | 182-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.