DPCstruct | MC14866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.34 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0378- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6ACG0 | 1-63 | MTIEQIAEDFGVHPMTLQKWLSRAAVDDGSKPGVTRGEASENRELRKRIRLLEQENEVLRRAA |
| Q325P0 | 61-155 | NTRFSPEVRQRAIRMVLESQGEYDSQWAAICSIAPKIGCTPETLRVWVRQHERDTGGGDGGLTTAKRQRLKELERENRELRRSNDIL… |
| A0A4Q1L0K1 | 1-73 | None |
| B9MJI0 | 1-65 | None |
| A0A6N7FMF4 | 67-166 | None |
| A0A1I2GII0 | 2-97 | None |
| A0A553ZQ62 | 2-89 | None |
| A0A7X3NBS6 | 1-88 | None |
| A0A076MQS2 | 128-221 | None |
| A0A2T6BRL5 | 6-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.