DPCstruct | MC14865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 73 ± 15 aa |
| Standard deviation of domain lengths | 14.84 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7IR96 | 8-55 | EHTPERKIHLYHCDHRGLPLALIDETGAIAWQAEYDEWGNQLAEENPS |
| Q320Q8 | 2-71 | TAAATATIIMMKNQMEPEYTPLRKIHLYHCDHRGLPLALIRSDGRTGWRVEYDEWGNLLSEDNPHRERSS |
| A0A827DCX7 | 212-302 | None |
| A0A377F8T6 | 57-125 | None |
| A0A377F8D7 | 23-95 | None |
| A0A5E8PCJ3 | 1-41 | None |
| A0A6D0NFF2 | 27-94 | None |
| A0A559QVU4 | 3-85 | None |
| A0A377D5W9 | 49-121 | None |
| A0A031HIP8 | 38-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.