DPCstruct | MC14860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Standard deviation of domain lengths | 15.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3BE91 | 287-378 | EVKMQIDNKDQMVKIGSVVEVKESFYIHAMDNIRANVIGFSVSNESKPNEMGYTIRLKDFQKRFSLDKQERIYRVEFYKNNAFSGMI… |
| A0A660WJ52 | 62-181 | IVKTSEKIEKISEEEKSSVSLVIEVDNHKIVVPSGDEIEVDKEAKIRIKRVLTNFPVKNPKANFIGFVGNKRFNDGQDIGYLITYRK… |
| A0A800C8T4 | 79-168 | None |
| A0A5C6MCT9 | 41-179 | None |
| A0A7C0XHK7 | 196-308 | None |
| A0A7Y8HN03 | 163-249 | None |
| A0A1Y6B773 | 10-125 | None |
| A0A1V5JNZ7 | 144-250 | None |
| A0A3D5Y8W4 | 2-100 | None |
| A0A3D8I1G6 | 372-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.