DPCstruct | MC1486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 56 ± 2 aa |
| Standard deviation of domain lengths | 2.18 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 31.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0Y4B2 | 1-56 | MLCNICNDDIFDSDDIKCSTCNEFLHFACAGFRETSFRKMSNNDKLNWCCNNCKFR |
| A0A1W4WP39 | 7-62 | SVCSKCQDPLPEFDFVTCSSCKGKLHYECAGVRESNWRKCSLELKRNWKCYACRQR |
| A0A821Y9J2 | 3-55 | None |
| A0A3Q0JLN1 | 1-59 | None |
| J9JUW6 | 4-56 | None |
| X1WKF1 | 2-58 | None |
| A0A821SNA4 | 6-60 | None |
| X1WRT9 | 2-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.