DPCstruct | MC14859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2T1Y4 | 238-324 | FLDTLETEFILVVEGAVATKDEGLYTIIARYQGELVTAMEAVKIAGERAKYVVTVGTCASYGGPSAARPNPSQSVSVPQLLNKEVIR |
| A0A660WJ14 | 1-104 | MLPKKKKKNYLLVVEGSIPTAEKGKYATVGEEKERTLTLLEELEELAKTALKIIALGSCSSFGGIPKAQPNPAECKSVKEILAEKNI… |
| A0A1G3QBH8 | 39-133 | None |
| A0A240AMU2 | 87-174 | None |
| Q7VJP5 | 102-199 | None |
| A0A0L6W2B0 | 93-185 | None |
| A0A7V4JRC2 | 147-233 | None |
| A0A7Z9ZEA7 | 8-106 | None |
| A0A644ZSR0 | 23-108 | None |
| X1J3W3 | 68-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.