DPCstruct | MC14853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 11.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4MQX2 | 2-95 | FEPCDANWRGIGVIPGSGLKLRDEMKHRDVSQVFSLDIPDAPEPKGCQCGLVLRGVKIPTDCKLFGKACTPEHPVGACMVSTEGSCA… |
| A0A496RN50 | 34-126 | EGCKRRGLGVIKKSGLSLKKGYVSFDARSLVKDTFCKKSSVDNCLCGEVIKGKIFPQMCPQFGRKCTPTTSLGPYMVSFEGGLQDLL… |
| A0A0J7KIL1 | 232-337 | None |
| A0A1F2VQY5 | 92-191 | None |
| A0A6A9T187 | 392-496 | None |
| A0A176YIY8 | 26-124 | None |
| A0A843DHA5 | 75-169 | None |
| A0A7C6AHZ0 | 2-82 | None |
| A0A833GXR1 | 198-308 | None |
| A0A376FFQ3 | 6-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.