DPCstruct | MC14845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 93 ± 16 aa |
| Standard deviation of domain lengths | 16.03 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.34 |
| Pfam Score | 99.02 |
| Assigned Pfam label(s) | CL0105- CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9USS0 | 96-212 | SNVNRNRKAPRLYMKATLAGYTRGLHGQRKKTAIIRIENANTRDDATWYTGKRVCYVYHGKKVKRCVRWSKAPARRSCTRAIWGRVT… |
| A0A287ATQ7 | 4-102 | RLWSNAIFAGYKRGLQNQREHKALLKIEGVHAQDETEFYLGKRCAYVFKAKNITMTPGRKPNKSRVFWGKGTRAHGNSGMGRVKFQS… |
| A0A452UA29 | 1-54 | None |
| A0A2I2Y724 | 3-75 | None |
| A0A0R3QI15 | 11-100 | None |
| A0A813FJ54 | 14-115 | None |
| A0A7C3TJN7 | 41-139 | None |
| A0A2J6XP60 | 2-85 | None |
| A0A7J3QBH8 | 4-92 | None |
| A0A180GX08 | 156-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.