DPCstruct | MC14844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 21.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847CXV8 | 3-99 | LNIATADQYLAIIFPAKMFKETYKEKNLDLRVLSRTLEDAGTLTSPLFAWNTCGAFISGALGVSPLAYLPYAILNWLNPIIAIIYGY… |
| H3NDR4 | 18-135 | ISNTFQLVASTILIYLVTTDVTSNGQVSILMPGEVLKNVYKKKGLHPKVLSRTLEDSVSCVECLIPWTAAGAYMAATLGVLTLTYLP… |
| A0A2T6EZ54 | 2-77 | None |
| C0Q4S4 | 452-583 | None |
| A0A3C1DB15 | 51-147 | None |
| A0A2G2L1K9 | 105-234 | None |
| A0A7W2B2R9 | 156-279 | None |
| A0A850R4S1 | 5-110 | None |
| A0A381GRW2 | 51-176 | None |
| A0A358Q5W2 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.