DPCstruct | MC14842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q82QI9 | 87-177 | EDVPAPELPVLLDMPGKVADFLREADLPDDQRSALAGGVTVRRGQGYTLRVNAAPSIHRELLARSQPLDGAQAVPAQRKARREYENR… |
| A0A5R8Z4F0 | 1-111 | MPDQLDAPPTDTGERHRVPALGLDATLDLPGLLADHLRTAGDETVRQALASGQTIRRGHGYSVRITAPLALHRAALEQSAALANAGP… |
| A0A5M3XDE7 | 120-218 | None |
| B4UYZ5 | 44-170 | None |
| A0A429E6N0 | 6-99 | None |
| A0A4Q9HQ31 | 44-137 | None |
| A0A4S2UJW2 | 255-357 | None |
| A0A7D3ZR88 | 45-137 | None |
| A0A3N4ZED7 | 117-211 | None |
| A0A6I6WM96 | 2-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.