DPCstruct | MC14841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 53 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 64.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831EVP6 | 1-52 | MVKASQKKSIDVIAREVIAGDWGNGDDRKNRLKKAGYDHVKVQNKVNEMLGR |
| A0A6N9K3T5 | 126-173 | LSPSRKSVDEIAREVIHGDWGNGSDRKKRITSAGYDYSAVQKRVNELL |
| A0A6H0UL77 | 61-106 | None |
| R6GU62 | 285-333 | None |
| A0A416RVT4 | 1-62 | None |
| A0A7T9WF03 | 11-71 | None |
| A0A352BK00 | 131-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.