DPCstruct | MC14840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255EBA4 | 2-147 | KQMAFFPVLAEDIRAILTGTAWTGVGHAATPEMRAGFGYADNEDEEADWAALTIASVAGVAIPTRIILAAEVSVDVGADTEFGEVTA… |
| C5C1Q2 | 1-151 | MRVYLPASARDLAAPDGPPVGTSAHAVTPALRAALPDEDTEGLELAALLAAADASIALVAERGDVPRRVVVAADVPDAEVSGEAPQD… |
| A0A839QQE2 | 1-140 | None |
| A0A417Z562 | 2-131 | None |
| A0A0Q7JUR7 | 1-160 | None |
| A0A316AX99 | 4-180 | None |
| A0A542ZUA0 | 1-174 | None |
| A0A3S4TBA5 | 31-195 | None |
| G8WWG1 | 103-289 | None |
| A0A7G9RDC5 | 3-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.