DPCstruct | MC14838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 152 ± 18 aa |
| Standard deviation of domain lengths | 17.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1HHZ2 | 2-163 | ENVLENKLVNIKSWKLGSKTAVHKPLLILYVLSQYKKGHKRLFNFEYELYDQVKSLLERYNQNSKSQHPEYPFWRLQKDGFWEVKIQ… |
| R6ETP6 | 12-155 | YDVYTKQIKKMAVGSIKRTGIKKIAKPVLLLAVIKGIEDGVFKQNRFEYEQLAEIYEVVFKKYAEIAKQSEYTLPCYPFYHMQTSDF… |
| A0A4Q0J4Y0 | 1-145 | None |
| A0A5Q5FZ24 | 1-164 | None |
| A0A4U0ZUM4 | 5-165 | None |
| A0A1V5D4E9 | 2-154 | None |
| M2WXS9 | 59-196 | None |
| A0A426TQL9 | 3-150 | None |
| A0A2Z4FQ43 | 17-208 | None |
| A0A0T9TIY6 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.