DPCstruct | MC14836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 137 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444JCA1 | 4-130 | QETHSVAMGYILWIFGFMGMHRFYYGKPISGTLYFFTLGLLGIGWIVDLFLIPGMDREADLRFTPGPNNYNIAWILLVFLGALGVHR… |
| A0A6M0JW12 | 4-131 | RDETHSILMGYLLWIFGFLGAHRFYYGKPVTGTIWLFTLGLLLIGWILDLFLIPGMSRRADIKFQRSSVSYNVAWILLTFLGIFGIH… |
| A0A7M7ND29 | 220-354 | None |
| A0A6J8ETU3 | 99-241 | None |
| A0A7I8VF07 | 52-208 | None |
| A0A7I8V8P9 | 146-292 | None |
| A0A8B6HE37 | 51-185 | None |
| A0A1S3IQX1 | 57-196 | None |
| A0A1S3IQG1 | 378-512 | None |
| K1Q2U9 | 187-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.