DPCstruct | MC14831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.13 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6YRR7 | 18-89 | HDVFIVGKSYQARWVGDADLKTEYKVIARTKSFVTLEIDGRNIGKKKIFLSDCGAEYCKPEGDYSMCPILRC |
| A0A7X4ZU21 | 1-72 | MKKFEVGKTYYSRSICNHECIFTIEVVKRTEKSVTYIYDGKQRRSMIKTDESGEYIKPDRYSMAPTFRADRE |
| A0A8B6J8E5 | 1-73 | None |
| A0A843H3G3 | 1004-1082 | None |
| A0A7X5KSN7 | 2-74 | None |
| U2KFD6 | 1-80 | None |
| A0A414A6D6 | 24-97 | None |
| A0A3E2UDS3 | 2-73 | None |
| A0A1M6XBM3 | 156-226 | None |
| Q0FLJ8 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.