DPCstruct | MC1483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 216 ± 24 aa |
| Standard deviation of domain lengths | 24.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.85 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0745- PF08961 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182M1J9 | 2-191 | YGRRAENCAKNRRFDEAIESHRKAVFHFNEALKLQTNAVVQESLQLQRKYHLKQVDWLLVKKQQYDRYLRALDYQRRKNPEFLAQQI… |
| A0A5E4QGB1 | 24-229 | PEAHQQHRRADAHLKNSKFDEAMQCHHNAAELLLDAMKTTSSTAALESITLQHSYHLKQKDLIKSKKEQYTRVKKAMENIKTLSKDP… |
| A0A6P3DST7 | 1-241 | None |
| A0A7I8V6Y3 | 1-185 | None |
| A0A3Q0DYD1 | 1-185 | None |
| A0A7R9P8Z2 | 185-430 | None |
| B0X118 | 24-213 | None |
| A0A6L2PPW3 | 3-257 | None |
| A0A834R4U6 | 1-234 | None |
| A0A821S6Z4 | 1-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.