DPCstruct | MC14823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.08 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0123- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7HEA6 | 4-97 | NSISNSVIRRLPRYYRFLGELENNGYVRISSRELSEKMGLTASQIRQDFNCFGEFGQQGYGYNVSDLRIEIGKILGLDKQTPMILLG… |
| A0A7Y1VST7 | 1-92 | MKELSKIPPATVKRLPLYLQCLEQVSSEDIGISSKTLAELAKVNDAQVRRDLSYLGTLGTRGVGYDISTLRNQIQLELGLVEGWSAV… |
| A0A2E7NGE3 | 1-81 | None |
| A0A800DLA7 | 36-154 | None |
| A0A1V4SCP1 | 13-85 | None |
| T0V7Z6 | 1-71 | None |
| A0A6G3V9C5 | 3-84 | None |
| A0A370IAG2 | 11-100 | None |
| A0A2N2H2Q2 | 2-91 | None |
| A0A143Q4D2 | 53-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.