DPCstruct | MC14821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 184 ± 18 aa |
| Standard deviation of domain lengths | 17.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0Q384 | 30-213 | RNERLTALAAAVLLVLFLIDLVFTADLRKFILVHIFIGTLLAGPLVVKLASVGYRFFSYYSKSPAFVEKGPPNIWLRLLAPFLILLT… |
| A0A538FWV4 | 22-204 | GADGNARLTATTGLILLVLLPIEGLTLLSLHSFLSLHMLVGVALIPPVALKLGSTFYRFFRYYTGSAIFREKGPPQLVMRILVAPAL… |
| A0A538L252 | 10-200 | None |
| A0A4V5MWA5 | 31-212 | None |
| A0A535E6Z2 | 4-161 | None |
| A0A2W6BDR0 | 16-208 | None |
| A0A535PMZ2 | 5-172 | None |
| A0A1M4UUF1 | 29-250 | None |
| A0A0D8HFG0 | 68-265 | None |
| A0A536JLX3 | 34-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.