DPCstruct | MC14820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2X4A1 | 75-148 | LTFQQEKAPGIAEDTSTIVAVDERVTTRAGSFTGCIKTEDFDPLGNTTEFKFYCPGVGLVREEYPSGHLDLVSY |
| A0A538FUD9 | 9-88 | DVYRQEFYPPGGALDQARVLGSEAARTVPYGTFKRVLDTVEWSPVEPQLERKYYVTGVGEIEEQVVHGGHERFQLVAVTH |
| A0A564WB77 | 145-246 | None |
| A0A7T5R911 | 157-246 | None |
| A0A5F0EL89 | 1-80 | None |
| A0A2V7TCT8 | 10-96 | None |
| A0A7W0SHZ0 | 27-119 | None |
| A0A0F8XRB6 | 75-146 | None |
| A0A7W0KVJ7 | 125-206 | None |
| A0A1F4R2N4 | 106-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.