DPCstruct | MC1482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Standard deviation of domain lengths | 17.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8CGD0 | 575-708 | PRGSSADLHHCTGSVRITPTDVNSRPSSCLTNFLLSGRSVMLEMPRRASGSKTLSHLMTSHGGEIFIHTLSISRSILEDPPSITEGS… |
| A7SEH2 | 1-121 | DLQPCIGSYRLTPVEVNSRPAACLISFLLQGRYVMLEQPRKTGSKVISHILMSHGGDIYIHCVSTSRTPNEDPPSISEGVGGRVTDY… |
| A0A484BBA6 | 229-346 | None |
| A0A5K4F9T5 | 91-230 | None |
| A0A7R9L5J6 | 340-461 | None |
| A0A0V0RRW8 | 1-143 | None |
| A0A183L0H2 | 10-147 | None |
| A0A2S2NR79 | 140-267 | None |
| A0A7R9BSE9 | 394-513 | None |
| A0A0R3X3L8 | 326-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.