DPCstruct | MC14819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 64 ± 2 aa |
| Standard deviation of domain lengths | 1.66 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0TFH8 | 5-67 | IKIVNINYQKVSFFQVLKRETVGKILSGLVFNLGYLWAAIDDKKQAWHDKIAKTYVIHVEPIS |
| A7C119 | 25-89 | MATNLKIVDAKTGNKLTLGQAIGRYFAYIPAILPLGLGIIWVGIDKKKQGWHDKLAGTVVIKSNQ |
| A0A258XC16 | 1-65 | None |
| A0A7C9NMW0 | 66-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.