DPCstruct | MC14816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383AIF9 | 7-101 | QQAEEMAREMAAVQEQIASAPASVVVANHLMGFYELAAIHLSQQPPNMSEASVAIDALGAVVEKLPGRLGEAEATMRDALHQIRLAY… |
| A0A538FNU9 | 1-87 | MEGRLSELRRQLAEAPASAVVANHCFGMFELAALHLSQQPPKLDDARLAIDALGCLVEGLEGRLGDQEPALKEGLTQLRLAFVQINS |
| A0A2E3JC28 | 37-135 | None |
| A0A6C7E6H5 | 18-138 | None |
| A0A6L5G1K6 | 43-168 | None |
| A0A7Y3LLI1 | 36-142 | None |
| A0A6J6QLN9 | 5-101 | None |
| A0A7K1BA61 | 16-122 | None |
| A0A399XM86 | 16-111 | None |
| A0A3D0TVU5 | 30-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.