DPCstruct | MC14815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9B689 | 1-107 | MSSRVHGIIDYLVAAVLLLAPYLFGFADGGPAQMVPTVLAIAIIIVSLLTRYELSVAKLIPYPIHLVLDLLVGLVLLVSPWLFNFAD… |
| A0A538FMM0 | 13-164 | SPVSPPDGGDRAWRRGEGGLPSRRQVPFGLHQGVDYLLALFLGELALHTRSETQRDLLVLGGVLVVVAVASDGPLSLVKAVPLWAHR… |
| A0A2W0BIY8 | 86-203 | None |
| A0A239IZ60 | 298-409 | None |
| A0A0K1QFX1 | 5-132 | None |
| A0A7W0ZZG9 | 30-163 | None |
| A0A3P0X6E0 | 13-129 | None |
| A0A2V7X5W3 | 42-179 | None |
| A0A7X6W1B0 | 2-133 | None |
| A0A7L5A7M4 | 3-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.