DPCstruct | MC14812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7L3Y0 | 1-158 | MLDKVEPPSIPEGYAMSVAFSALLDLVRGITSLIERELTAEEEAAAEFRETHPEQEWKPEPGAHLVWEEMVNASWCGLLAALSLLLD… |
| A0A7R9HHA9 | 1-142 | MLDKSEPPSIPDGYGVSIAYAYLLDIVRSIALAIEGVSPNGEEQPVVELYKGSEEDRKLHQQLINSSWCGLLAALSPLMDASTDESV… |
| A0A7R9LL38 | 172-306 | None |
| A0A6I9N9H5 | 92-243 | None |
| A0A438GDI5 | 29-163 | None |
| A0A821Q1M1 | 331-505 | None |
| R7ULJ2 | 504-648 | None |
| A0A182SGE3 | 124-278 | None |
| A0A1B0DFD9 | 2-142 | None |
| A0A2D4IJU2 | 362-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.