DPCstruct | MC14811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 177 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.46 |
| Pfam Score | 85.91 |
| Assigned Pfam label(s) | CL0023- CL0220- PF08355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9HDR8 | 1-213 | MVSVPDSVRVGCMVSVPDSGRVGCFLFLHCLFIQRGRNETTWAVLRKFGYNDNLQITKEYLHPSVRVPAGCTTELSLKGQHFVSTLF… |
| A0A672KYU0 | 139-311 | NVVRKNMSDGVKDNGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLELTQEYLFPLLKIPPDCTTELNHNAYLFLQSVFDKND… |
| A0A7J7T397 | 105-275 | None |
| B7PAT4 | 190-391 | None |
| A0A178EUM6 | 233-409 | None |
| A0A0R3TDI0 | 1-187 | None |
| A0A5N6WGT1 | 101-277 | None |
| A0A183NUX0 | 80-279 | None |
| A0A0K8TES0 | 105-262 | None |
| A0A183EEU0 | 97-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.