DPCstruct | MC1481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19933 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6N3X4 | 255-346 | YLALEKDEERSRRYKILSDILGRYSYLKPTVNDIDDIVPLPPAKLPPWDGKIKWLKEWESNVPPPLPSEARIAEMAKAKGLNPATGM… |
| A0A448F7K7 | 2-94 | SHPDDERAKRYSVIRSYLSRYDYLQPKVPDLDEIVPLPPAKLPKWDGKIAFQRWYEGEAPPKPSEALMQKLANQAGLRVDTGLDLET… |
| A0A1E9VUX5 | 188-275 | None |
| A2W084 | 402-493 | None |
| A0A0P9H8V4 | 74-157 | None |
| A0A7W7JL92 | 18-97 | None |
| A0A447LLG0 | 79-163 | None |
| A0A0P9RUD8 | 117-208 | None |
| A0A378WRE5 | 109-196 | None |
| A0A7V8SDJ4 | 163-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.