DPCstruct | MC14806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401SWT2 | 101-223 | FLVVPLAYSGKQPFRKGQDQWLHAGPPNNEYMDQNFQHLNGILNLPSSDVAIKEAFHNSQLVGRPLELWIYESVGKFWSATNTCTVE… |
| A0A4Y2ISU9 | 699-813 | YNGHEVSSEQVKFLHNGPGQPYVDHDFSNVEALLGYANKSVQARQALSNSRRYGKDLKEWTDTLVSSFWSVQDTCFVNQPLHPSGGA… |
| A0A1S3QSL7 | 286-399 | None |
| A0A3Q0JG78 | 3-115 | None |
| A0A443S9P9 | 144-245 | None |
| A0A6A4WL99 | 473-593 | None |
| A0A0A9WGN7 | 366-479 | None |
| G3HBF2 | 64-191 | None |
| A0A4Z2F479 | 166-281 | None |
| S4PXP3 | 98-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.