DPCstruct | MC14804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 298 ± 42 aa |
| Standard deviation of domain lengths | 42.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2EC38 | 2-244 | GKLIAWEILLVQICQCLNEWPRKHPESTSIGQKCKQCIMSLQNGDAAIPRTEILEYSIAMLLNLSDWASLILPDKRSPILEVSSALA… |
| A0A7R9GUT7 | 5-269 | TAVLSTASMLYKMGKLLSWEGLLIKIIQFLLDWPCPSINSQSLTTDCKTCLSALKAGDSVIPRLEILEHCALCLLNLGEWEFLVNIE… |
| A0A821HK29 | 2-246 | None |
| A0A212CEM8 | 563-863 | None |
| A0A182E9X4 | 1-371 | None |
| A0A6G1RVD7 | 1-330 | None |
| A0A0K2TV39 | 157-455 | None |
| B6S336 | 391-719 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.