DPCstruct | MC14803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 254 ± 50 aa |
| Standard deviation of domain lengths | 50.01 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1BNF9 | 2-186 | RFYARFIIVCLLLNKNGNVQKLISELEVLTEEYVKTFKPPDAKEWQMVLEEVSTFTEAEKKLIPINLDKTPDKIEHRLSHTIEERPG… |
| A0A7R9GUF7 | 108-325 | RFIVVCLLLKKMKLVRDLVMELDNQIADYTSTYEPDDQLEWSLVLEEIKSFIKADGVVSVLHADSNTIVLSHRLSPLTTPPVEKSPI… |
| A0A2V0PLE0 | 58-399 | None |
| A0A446UCE8 | 7-202 | None |
| A0A1Y1W115 | 136-453 | None |
| L9JDX3 | 57-288 | None |
| A0A199VMI1 | 194-485 | None |
| A0A6I9YKV1 | 1-198 | None |
| A0A2N9INW2 | 361-546 | None |
| A0A453L190 | 13-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.