DPCstruct | MC14800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 76 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3ZD25 | 78-145 | ERPDVWEAISEKYAQQVSGEIRAVIGNSRRSGNVWESFELPALKKNPKVTKVTTIDPKTGKENVIFKR |
| A0A2A5NVQ7 | 141-208 | KPRTVEAWRTVSEKFAEGASGEVHLIGGTGIRPTSIWVTREFEALKNNPAITKIVQVDPASGYTRVIW |
| A0A369JDK9 | 117-184 | None |
| A0A370TWY6 | 138-214 | None |
| A0A3R7T0W6 | 977-1042 | None |
| A0A1X1VI46 | 241-315 | None |
| A0A7R7ZP77 | 102-169 | None |
| A0A0L6WD13 | 78-147 | None |
| A0A6A5Z3B6 | 120-191 | None |
| A0A6A0BCR4 | 70-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.