DPCstruct | MC148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D8DA46 | 3-66 | PYKNIHRLSSILAYELGDESIRIEFVSGAVREYTYANVGRDHVEAMKKCATKGKGLGSYVMKNE |
| A0A519KD07 | 6-73 | RHIYKSLDGQSAICCYECGSDYIKVQFKETGMIYKFSHRTAGRKHVSAMKKLAATGHGLGNYIELFIV |
| A0A5B8UYP1 | 2-76 | None |
| A0A1F3QHH8 | 4-69 | None |
| A0A424L3I9 | 1-75 | None |
| A0A3E2NUI9 | 7-83 | None |
| A0A7W6CWQ3 | 18-87 | None |
| A0A7W8G0B6 | 67-139 | None |
| B0V6K4 | 20-89 | None |
| J6GTM8 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.