DPCstruct | MC14795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5TVC6 | 1-100 | MHKFRRTVKDVIGVVKVCQTTLRKRLTEFEDTPTSQLTIDEFMRVDLEQECDPPSFIAAQHKAKMQQLEQELARKLDDVEGEISCYK… |
| A0A672M6U2 | 1-87 | MHEFRRTVKEVISVVKVCEATLRKRLTEFEETPTSALTIDEFMRVDLEKECDPPSFVAGQKKLKMQQILILSIDSTWHLNALCGALS |
| A0A166CFM5 | 1-91 | None |
| A0A564YLQ3 | 33-125 | None |
| A0A2G8JV33 | 33-128 | None |
| A0A0X3QFW8 | 112-206 | None |
| M5BQM3 | 1-71 | None |
| A0A0D2UJF9 | 232-297 | None |
| A0A1B0CP18 | 1-91 | None |
| D6WSI6 | 27-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.