DPCstruct | MC14794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 177 |
|---|---|
| Mean domain length (aa) | 126 ± 27 aa |
| Standard deviation of domain lengths | 27.23 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 27.21 |
| Pfam Score | 83.62 |
| Assigned Pfam label(s) | PF00095- CL0692- CL0030- PF14625- CL0620 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672M2X2 | 41-153 | SAKPGVFQSFVCITEKPGVCPRRFIGVGLCKTLCVSDIDCPKDEKCCSTKCGRECTPPFIEKPGVCPSRSLRIGVCAEMCSHDRDCP… |
| P84811 | 19-132 | RYCHSDRECKAGYYCCNTGCLNICVPKPKPGLCPAIRPGPCKGNVCSNDQDCPGNQKCCGKPGCRRCYRPEKPGSCPPRKYDAGVCV… |
| A0A5S6Q3M3 | 4-150 | None |
| A0A5S6QQ53 | 8-138 | None |
| A0A5S6QHR7 | 26-187 | None |
| A0A5S6QK39 | 68-219 | None |
| A0A5S6QNB6 | 48-197 | None |
| A0A5S6QP59 | 81-223 | None |
| A0A5S6QPC9 | 63-221 | None |
| A0A5S6QUB8 | 89-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.