DPCstruct | MC14793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 161 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.14 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0662- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4E8E6 | 3-164 | EYIRSPLIRLMYEKLDHQNKHSNSNHDHWYDYRTEYVDSELRDKFIKSKQDEETCKFLENCYIKSDWLFTHFYHAIAKAVLTWFMTS… |
| A0A672M139 | 27-178 | TAPLTSSCCCCMLWMCLQWYHCCLDMLGEQVRSQFVQSHLDEDTQTFLRRSVEKSSWLFTQLYHSLFSTILSPVMSRTSINGFLGRG… |
| A0A818GHV2 | 74-220 | None |
| A0A6A4WVM4 | 8-168 | None |
| A0A0P1AIE7 | 435-606 | None |
| A0A2A2KNT7 | 16-176 | None |
| A0A0R3U7K9 | 1-163 | None |
| A0A0G4HSM3 | 82-214 | None |
| A0A504X686 | 6-160 | None |
| A0A7S4A540 | 9-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.