DPCstruct | MC14792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 70 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 25.65 |
| Pfam Score | 61.11 |
| Assigned Pfam label(s) | CL0123- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1ZWX1 | 1-56 | MKKDRTIIQVGATGPVATFKTTYEAQKETGINQSNISKCLRGILKKTGGYRWVYAD |
| A0A415IRW2 | 46-113 | LKNLSLGRKGNPSIAGNNARPIVAIKDRRLIAVFPSSNAAERKTGICSRNIRSCCSGKRKHAGGYEWF |
| A0A495SMJ8 | 173-240 | None |
| A0A410Q110 | 16-81 | None |
| A0A416P0F2 | 109-175 | None |
| A0A7C1L0K5 | 42-106 | None |
| A0A7S2UBD1 | 769-831 | None |
| A0A166VCV3 | 254-314 | None |
| A0A4Q1EN27 | 146-216 | None |
| A0A6A1R1F3 | 50-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.