DPCstruct | MC14789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7I7Y7 | 22-117 | MSRKNHKRVNGRLLQMDKQFSDLKERQKSRIAEWLYMAYREACLRTGREPDKEADREILNSVMAKIEDAEIWIPYGEIVSYYRRRKK… |
| A0A1I0YED6 | 10-88 | NKKWCQLNKKEQIIVSTMLRDLYIRFVVENNRKPNRDEKQFIVATVYLKTEEEDIFIPANQINKYFQSKIPNYDKSIEK |
| A0A1T5LB82 | 1-94 | None |
| A0A243KXM2 | 1-97 | None |
| A0A1Y4STZ7 | 1-87 | None |
| A0A174TEX8 | 13-105 | None |
| A0A1G6FHV0 | 1-87 | None |
| A0A1K1Q1R7 | 4-96 | None |
| A0A3C1YHG5 | 2-90 | None |
| A0A6N2XRD1 | 15-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.