DPCstruct | MC14783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 172 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0020- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4HRK2 | 14-179 | QPELWAQVLVSDNLHRRALIDQIVATALPESTDPDDVSVTVKAFLIADLPIELIELLEKIIIELSPFNDNKNLQNLLPLTAVCADKG… |
| A0A2G5C5I1 | 4-166 | DLWEKVLSPDNEYRRKLIDQVVTALPECKSAEQVSAAIKAFMTADLPHELIELLEKLVLHNSVFGGNFNLQNLLILSAIKADASRVM… |
| A0A819NSB9 | 732-916 | None |
| A0A2P2MIV2 | 143-323 | None |
| Q10161 | 935-1113 | None |
| A0A4Y9ZQL1 | 642-834 | None |
| A0A4Y9ZVK1 | 11-191 | None |
| A0A314YYV2 | 318-494 | None |
| A0A815MS03 | 19-178 | None |
| A0A821H202 | 3-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.