DPCstruct | MC14781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 7.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M4FGU9 | 163-247 | FRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPINQYPHAVGKNTLLIAGLQARNNARVVFSGSLDFFSDAFFNSAVQKAVPGSK |
| A0A2G5C1M8 | 15-75 | LFKGIGHTLNPANSLVVKVLSASPSAYSELPNPPSVTGSAISLVSVVQARNNARIAISGFI |
| A0A151I0R4 | 260-344 | None |
| A0A3Q7EUP1 | 482-549 | None |
| A0A2T7PUD8 | 502-585 | None |
| A0A199VIQ7 | 114-176 | None |
| A0A482VC28 | 529-607 | None |
| F1N632 | 278-370 | None |
| C0HJ14 | 37-105 | None |
| A0A4Z2EFP5 | 206-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.