DPCstruct | MC14779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 5.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8HHC1 | 1-54 | ISPNPGCIRALMKMLYCPYCRGLPSVRPCSNYCLNVMKGCLANQADLDIEWNLF |
| A0A4D9EUA7 | 1-50 | MKMLYCPYCRGLPTVKPCNNYCLNVMKGCLANQADLDTEWNLFIGKRSLN |
| A0A6A4W975 | 312-368 | None |
| A0A151NRQ2 | 1-50 | None |
| A0A0S7KK94 | 234-291 | None |
| G3PLC6 | 58-112 | None |
| A0A3Q1EF06 | 122-175 | None |
| A0A556TK83 | 143-196 | None |
| A0A4U1F8J6 | 285-342 | None |
| A0A5C6PM28 | 115-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.