DPCstruct | MC14774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 77 ± 1 aa |
| Standard deviation of domain lengths | 0.90 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 72.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 58.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01480 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8H038 | 1-77 | MADAGFFRGVAADQDSRFSDKQKKLLKSMHFASNLETKIDMKKVKLDTLKPWITKRLTEILTFEDDVVTEFVFTYLE |
| A0A5C3DYC3 | 1-76 | MGDSSYKGVSAAQDSRFTNKQTVLLRKLKFPPHFDVKVDMRKVELSVMKPWIARRIIELLGFEDDVVLEYASGMLE |
| F1L7C5 | 1-77 | None |
| A0A210Q8E2 | 1-79 | None |
| A0A818JH12 | 1-77 | None |
| J9EY69 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.