DPCstruct | MC14772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2MQ68 | 16-78 | VSFADGYPYLIIGTASIDDLNHKIGSPVDINRFRPNILINTKSAFEEDLWKVVSIGESDLQVV |
| A0A6J3QW96 | 207-267 | YSDASPFLILSEASLADLNSRLEKKVKATNFRPNIIISGCGVYAEDSWNELLIGDVELKRV |
| A0A2R7VX96 | 159-223 | None |
| A0A7J0EH45 | 364-439 | None |
| A0A446UK52 | 63-137 | None |
| A0A3P6QFE4 | 1-61 | None |
| A0A094K907 | 49-135 | None |
| A0A022QYG1 | 358-422 | None |
| A0A0B8NMI8 | 2-58 | None |
| A0A803QDL0 | 796-860 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.