DPCstruct | MC14770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 18 aa |
| Standard deviation of domain lengths | 17.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A222EAP2 | 80-233 | VLTLSREYFRLRKPLERRIYELARKHCGRQKEWRVSMEVLQKKCGSGSTLREFRRLVTAIVKEDEDYNHMPDYQIRIDTERNQLLVR… |
| B6ASK0 | 1-153 | MLTLSTDYFRLRKPLERRIYELARKHCGRQKSWRVSVEVLLKKSGSASPRRVFRKMIRDMIAADHLPDYEMSEEEGDLIRFTTRDAV… |
| A0A482Z3I4 | 1-107 | None |
| A0A177G460 | 20-173 | None |
| A0A7Z8QNC0 | 2-124 | None |
| A0A7U7J3Z1 | 1-168 | None |
| A0A2D0N751 | 104-258 | None |
| U9VWW1 | 140-300 | None |
| A0A4R5ZZC7 | 188-341 | None |
| A0A177T1K5 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.