DPCstruct | MC14769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7LT35 | 6-102 | TPGSDDLAVALRVFEKYFQLIRNILRTYTLEPAGSHGVWGLDDHSFIPYLFGSSQLRQQSSSVSPADITNAKIVERERHNNLYFGAI… |
| A0A6G1MLL1 | 43-141 | CLHQLSHLTPTSFSSIPLRIFPTYLTIMRHVQQEYYLEPAGSHGVWGLDDYQFLPFVFGSSQLFHHPYLRPISIHNADILEELSSEY… |
| A0A2S2NM50 | 10-107 | None |
| A0A5J4NDR3 | 15-105 | None |
| U6JXL0 | 1-94 | None |
| A0A1E4SWW5 | 1-108 | None |
| A0A6U0IQY9 | 28-126 | None |
| A0A438FZJ7 | 366-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.